Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) |
Family d.190.1.3: AF1396-like [160415] (2 proteins) Pfam PF01947; DUF98 |
Protein automated matches [190745] (1 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [187930] (1 PDB entry) |
Domain d2nwid2: 2nwi D:2-160 [148491] Other proteins in same PDB: d2nwia1, d2nwia2, d2nwib3, d2nwic3, d2nwid3, d2nwie3 automated match to d2nwia1 |
PDB Entry: 2nwi (more details), 2.2 Å
SCOPe Domain Sequences for d2nwid2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nwid2 d.190.1.3 (D:2-160) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} naihrilmttdgsitaiieavtqkkvevetleqkiiradrelaelleidegdevnyrvvy lrangeiyakaisftplkrlensfredlmradipigkimrkhniearreirwsrveeadl alakelgiadrrvisrnyniihrgkvliniteffpmerf
Timeline for d2nwid2: