SCOPe 2.08: Domain d2nwib2: 2nwi B:2-160

Lineage for d2nwib2 (2nwi B:2-160)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (4 families)

5. Family d.190.1.3: AF1396-like [160415] (2 proteins)
   Pfam PF01947; DUF98

6. Protein automated matches [190745] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [187930] (1 PDB entry)

8. Domain d2nwib2: 2nwi B:2-160 [148489]
   Other proteins in same PDB: d2nwia1, d2nwia2, d2nwib3, d2nwic3, d2nwid3, d2nwie3
   automated match to d2nwia1

Details for d2nwib2

PDB Entry: 2nwi, 2.2 Å

PDB Description: crystal structure of protein af1396 from archaeoglobus fulgidus, pfam duf98

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2nwib2:

Sequence, based on SEQRES records:

>d2nwib2 d.190.1.3 (B:2-160) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
naihrilmttdgsitaiieavtqkkvevetleqkiiradrelaelleidegdevnyrvvy
lrangeiyakaisftplkrlensfredlmradipigkimrkhniearreirwsrveeadl
alakelgiadrrvisrnyniihrgkvliniteffpmerf

Sequence, based on observed residues (ATOM records):

>d2nwib2 d.190.1.3 (B:2-160) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
naihrilmttdgsitaiieavtqkkvevetleqkiiradrelaelleidegdevnyrvvy
lrangeiyakaisftplkrlensfredlgkimrkhniearreirwsrveeadlalakelg
iadrrvisrnyniihrgkvliniteffpmerf

Timeline for d2nwib2:

• d2nwib2 first appeared in SCOP 1.75, called d2nwib1
  
• d2nwib2 appears in SCOPe 2.07