Lineage for d2nwaf_ (2nwa F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1813773Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1813774Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1814019Family b.122.1.13: YtmB-like [159372] (1 protein)
    PfamB PB020780
    automatically mapped to Pfam PF10763
  6. 1814020Protein Hypothetical protein YtmB [159373] (1 species)
  7. 1814021Species Bacillus subtilis [TaxId:1423] [159374] (1 PDB entry)
    Uniprot O34365 1-80
  8. 1814027Domain d2nwaf_: 2nwa F: [148485]
    automated match to d2nwaa1
    complexed with so4

Details for d2nwaf_

PDB Entry: 2nwa (more details), 2.7 Å

PDB Description: x-ray crystal structure of protein ytmb from bacillus subtilis. northeast structural genomics consortium target sr466
PDB Compounds: (F:) Hypothetical protein ytmB

SCOPe Domain Sequences for d2nwaf_:

Sequence, based on SEQRES records: (download)

>d2nwaf_ b.122.1.13 (F:) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfgeksgtaevqkl
qweegrtiitykltslhsvnl

Sequence, based on observed residues (ATOM records): (download)

>d2nwaf_ b.122.1.13 (F:) Hypothetical protein YtmB {Bacillus subtilis [TaxId: 1423]}
mgmpvefntlivtkgkevrideniftlekdgyrvypmeipmdvrktkfeksgtaevqklq
weegrtiitykltslhsvnl

SCOPe Domain Coordinates for d2nwaf_:

Click to download the PDB-style file with coordinates for d2nwaf_.
(The format of our PDB-style files is described here.)

Timeline for d2nwaf_: