Lineage for d2nvle_ (2nvl E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2877891Species Aeropyrum pernix [TaxId:272557] [186846] (19 PDB entries)
  8. 2877935Domain d2nvle_: 2nvl E: [148472]
    automated match to d1x0ra1

Details for d2nvle_

PDB Entry: 2nvl (more details), 2.36 Å

PDB Description: crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfonic acid form)
PDB Compounds: (E:) Probable peroxiredoxin

SCOPe Domain Sequences for d2nvle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvle_ c.47.1.10 (E:) automated matches {Aeropyrum pernix [TaxId: 272557]}
sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed
fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesath
tvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiige
glivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllye
ea

SCOPe Domain Coordinates for d2nvle_:

Click to download the PDB-style file with coordinates for d2nvle_.
(The format of our PDB-style files is described here.)

Timeline for d2nvle_: