![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (23 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
![]() | Protein Peroxiredoxin [117601] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [117602] (5 PDB entries) Uniprot Q9Y9L0 # APE2278 |
![]() | Domain d2nvla1: 2nvl A:4-242 [148468] automatically matched to d1x0ra1 mutant |
PDB Entry: 2nvl (more details), 2.36 Å
SCOP Domain Sequences for d2nvla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvla1 c.47.1.10 (A:4-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesath tvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiige glivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpaklly
Timeline for d2nvla1: