Lineage for d2nvla1 (2nvl A:4-242)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 834330Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 834442Protein Peroxiredoxin [117601] (1 species)
  7. 834443Species Aeropyrum pernix [TaxId:56636] [117602] (5 PDB entries)
    Uniprot Q9Y9L0 # APE2278
  8. 834474Domain d2nvla1: 2nvl A:4-242 [148468]
    automatically matched to d1x0ra1
    mutant

Details for d2nvla1

PDB Entry: 2nvl (more details), 2.36 Å

PDB Description: crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfonic acid form)
PDB Compounds: (A:) Probable peroxiredoxin

SCOP Domain Sequences for d2nvla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvla1 c.47.1.10 (A:4-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}
sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed
fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesath
tvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiige
glivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpaklly

SCOP Domain Coordinates for d2nvla1:

Click to download the PDB-style file with coordinates for d2nvla1.
(The format of our PDB-style files is described here.)

Timeline for d2nvla1: