SCOPe 2.07: Domain d2nvbd1: 2nvb D:1-139,D:314-352

Lineage for d2nvbd1 (2nvb D:1-139,D:314-352)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)

7. Species Thermoanaerobacter brockii [TaxId:29323] [50144] (3 PDB entries)

8. Domain d2nvbd1: 2nvb D:1-139,D:314-352 [148466]
   Other proteins in same PDB: d2nvba2, d2nvbb2, d2nvbc2, d2nvbd2
   automatically matched to d1bxza1
   complexed with nap, zn

Details for d2nvbd1

PDB Entry: 2nvb, 2.8 Å

PDB Description: contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs)

PDB Compounds: (D:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d2nvbd1:

Sequence; same for both SEQRES and ATOM records:

>d2nvbd1 b.35.1.2 (D:1-139,D:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila

Timeline for d2nvbd1:

• d2nvbd1 first appeared in SCOP 1.75
  
• d2nvbd1 appears in SCOPe 2.06
  
• d2nvbd1 appears in the current release, SCOPe 2.08