SCOPe 2.08: Domain d2nvbb2: 2nvb B:140-313

Lineage for d2nvbb2 (2nvb B:140-313)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)

7. Species Thermoanaerobacter brockii [TaxId:29323] [51744] (3 PDB entries)

8. Domain d2nvbb2: 2nvb B:140-313 [148463]
   Other proteins in same PDB: d2nvba1, d2nvbb1, d2nvbc1, d2nvbd1
   automatically matched to d1bxza2
   complexed with nap, zn

Details for d2nvbb2

PDB Entry: 2nvb, 2.8 Å

PDB Description: contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs)

PDB Compounds: (B:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d2nvbb2:

Sequence; same for both SEQRES and ATOM records:

>d2nvbb2 c.2.1.1 (B:140-313) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
ipleaavmipdmmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgs
rpvcvdaakyygatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpg
gtianvnyfgegevldvprlewgcgmahktikgglcpggrlrmerlidlvfykr

Timeline for d2nvbb2:

• d2nvbb2 first appeared in SCOP 1.75
  
• d2nvbb2 appears in SCOPe 2.07