Lineage for d2nuob1 (2nuo B:1-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422611Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2422652Protein Griffithsin [141569] (2 species)
    single-chain subunits form a segment-swapped dimer
  7. 2422653Species Griffithsia sp. Q66D336 [TaxId:373036] [159279] (1 PDB entry)
  8. 2422655Domain d2nuob1: 2nuo B:1-121 [148457]
    automatically matched to d2gtya1
    complexed with bgc, edo, so4

Details for d2nuob1

PDB Entry: 2nuo (more details), 1.5 Å

PDB Description: crystal structure of a complex of griffithsin with glucose
PDB Compounds: (B:) Griffithsin

SCOPe Domain Sequences for d2nuob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuob1 b.77.3.1 (B:1-121) Griffithsin {Griffithsia sp. Q66D336 [TaxId: 373036]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

SCOPe Domain Coordinates for d2nuob1:

Click to download the PDB-style file with coordinates for d2nuob1.
(The format of our PDB-style files is described here.)

Timeline for d2nuob1: