Lineage for d2nuob1 (2nuo B:1-121)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.77: beta-Prism I [51091] (4 superfamilies)
consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
duplication: has internal pseudo threefold symmetrySuperfamily b.77.3: Mannose-binding lectins [51101] (2 families) 
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) Protein Griffithsin [141569] (2 species)
single-chain subunits form a segment-swapped dimer
Species Griffithsia sp. Q66D336 [TaxId:373036] [159279] (1 PDB entry) 
Domain d2nuob1: 2nuo B:1-121 [148457]
automatically matched to d2gtya1
complexed with bgc, edo, so4
Details for d2nuob1
PDB Entry: 2nuo (more details), 1.5 Å
PDB Description: crystal structure of a complex of griffithsin with glucose
PDB Compounds: (B:) GriffithsinSCOPe Domain Sequences for d2nuob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuob1 b.77.3.1 (B:1-121) Griffithsin {Griffithsia sp. Q66D336 [TaxId: 373036]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y
SCOPe Domain Coordinates for d2nuob1:
Click to download the PDB-style file with coordinates for d2nuob1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nuob1:
- d2nuob1 first appeared in SCOP 1.75
- d2nuob1 appears in SCOPe 2.07
View in 3D
