SCOP 1.75: Domain d2nuga1: 2nug A:3-150

Lineage for d2nuga1 (2nug A:3-150)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (2 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d2nuga1: 2nug A:3-150 [148452]
   Other proteins in same PDB: d2nuga2, d2nugb2
   automatically matched to d1rc7a1
   complexed with mg

Details for d2nuga1

PDB Entry: 2nug, 1.7 Å

PDB Description: crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 1.7-angstrom resolution

PDB Compounds: (A:) Ribonuclease III

SCOP Domain Sequences for d2nuga1:

Sequence; same for both SEQRES and ATOM records:

>d2nuga1 a.149.1.1 (A:3-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
mleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspnk
regflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsgr
danftrelfyklfkedilsaikegrvkk

Timeline for d2nuga1:

• d2nuga1 is new in SCOP 1.75
  
• d2nuga1 appears in SCOPe 2.01
  
• d2nuga1 appears in the current release, SCOPe 2.08