Lineage for d2nufb2 (2nuf B:151-220)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859886Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 859887Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 859888Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 859914Protein RNase III, C-terminal domain [54776] (3 species)
  7. 859915Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)
  8. 859926Domain d2nufb2: 2nuf B:151-220 [148451]
    Other proteins in same PDB: d2nufa1, d2nufb1
    automatically matched to d1rc7a2
    complexed with mg

Details for d2nufb2

PDB Entry: 2nuf (more details), 2.5 Å

PDB Description: crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.5-angstrom resolution
PDB Compounds: (B:) Ribonuclease III

SCOP Domain Sequences for d2nufb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nufb2 d.50.1.1 (B:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOP Domain Coordinates for d2nufb2:

Click to download the PDB-style file with coordinates for d2nufb2.
(The format of our PDB-style files is described here.)

Timeline for d2nufb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nufb1