| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III domain-like [69065] (3 families) ![]() |
| Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
| Protein RNase III endonuclease catalytic domain [69067] (2 species) |
| Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries) |
| Domain d2nufb1: 2nuf B:2-150 [148450] Other proteins in same PDB: d2nufa2, d2nufb2 automated match to d1rc7a1 protein/RNA complex; complexed with mg |
PDB Entry: 2nuf (more details), 2.5 Å
SCOPe Domain Sequences for d2nufb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nufb1 a.149.1.1 (B:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
rdanftrelfyklfkedilsaikegrvkk
Timeline for d2nufb1: