| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
| Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
| Protein RNase III, C-terminal domain [54776] (3 species) |
| Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries) |
| Domain d2nufa2: 2nuf A:151-220 [148449] Other proteins in same PDB: d2nufa1, d2nufb1 automated match to d2nugb2 protein/RNA complex; complexed with mg |
PDB Entry: 2nuf (more details), 2.5 Å
SCOPe Domain Sequences for d2nufa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nufa2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees
Timeline for d2nufa2: