Lineage for d2nufa1 (2nuf A:2-150)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779052Fold a.149: RNase III domain-like [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 779053Superfamily a.149.1: RNase III domain-like [69065] (2 families) (S)
  5. 779054Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
    Pfam PF00636
  6. 779058Protein RNase III endonuclease catalytic domain [69067] (2 species)
  7. 779059Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)
  8. 779069Domain d2nufa1: 2nuf A:2-150 [148448]
    Other proteins in same PDB: d2nufa2, d2nufb2
    automatically matched to d1rc7a1
    complexed with mg

Details for d2nufa1

PDB Entry: 2nuf (more details), 2.5 Å

PDB Description: crystal structure of rnase iii from aquifex aeolicus complexed with ds-rna at 2.5-angstrom resolution
PDB Compounds: (A:) Ribonuclease III

SCOP Domain Sequences for d2nufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nufa1 a.149.1.1 (A:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
rdanftrelfyklfkedilsaikegrvkk

SCOP Domain Coordinates for d2nufa1:

Click to download the PDB-style file with coordinates for d2nufa1.
(The format of our PDB-style files is described here.)

Timeline for d2nufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nufa2