Lineage for d2nuab1 (2nua B:239-388)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856295Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 2856296Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
  8. 2856313Domain d2nuab1: 2nua B:239-388 [148438]
    Other proteins in same PDB: d2nuaa1, d2nuaa2, d2nuab2, d2nuad1, d2nuad2, d2nuae2
    automated match to d1jkjb1
    complexed with coa, po4, so4; mutant

Details for d2nuab1

PDB Entry: 2nua (more details), 2.95 Å

PDB Description: c123av mutant of e. coli succinyl-coa synthetase
PDB Compounds: (B:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nuab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuab1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

SCOPe Domain Coordinates for d2nuab1:

Click to download the PDB-style file with coordinates for d2nuab1.
(The format of our PDB-style files is described here.)

Timeline for d2nuab1: