Lineage for d2nuaa2 (2nua A:122-287)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158469Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 1158470Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1158477Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)
  7. 1158478Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 1158497Domain d2nuaa2: 2nua A:122-287 [148437]
    Other proteins in same PDB: d2nuaa1, d2nuab1, d2nuab2, d2nuad1, d2nuae1, d2nuae2
    automatically matched to d1oi7a2
    complexed with coa, po4, so4; mutant

Details for d2nuaa2

PDB Entry: 2nua (more details), 2.95 Å

PDB Description: c123av mutant of e. coli succinyl-coa synthetase
PDB Compounds: (A:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2nuaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuaa2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
nvpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

SCOPe Domain Coordinates for d2nuaa2:

Click to download the PDB-style file with coordinates for d2nuaa2.
(The format of our PDB-style files is described here.)

Timeline for d2nuaa2: