Lineage for d2nu9b2 (2nu9 B:1-238)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219587Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1219773Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 1219774Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 1219775Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 1219790Domain d2nu9b2: 2nu9 B:1-238 [148423]
    Other proteins in same PDB: d2nu9a1, d2nu9a2, d2nu9b1, d2nu9d1, d2nu9d2, d2nu9e1, d2nu9f1, d2nu9f2, d2nu9g1, d2nu9h1, d2nu9h2, d2nu9i1
    automatically matched to d1cqib2
    complexed with coa, so4; mutant

Details for d2nu9b2

PDB Entry: 2nu9 (more details), 2.9 Å

PDB Description: c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form
PDB Compounds: (B:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nu9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu9b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d2nu9b2:

Click to download the PDB-style file with coordinates for d2nu9b2.
(The format of our PDB-style files is described here.)

Timeline for d2nu9b2: