SCOPe 2.02: Domain d2nu8e2: 2nu8 E:1-238

Lineage for d2nu8e2 (2nu8 E:1-238)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)

7. Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)

8. Domain d2nu8e2: 2nu8 E:1-238 [148419]
   Other proteins in same PDB: d2nu8a1, d2nu8a2, d2nu8b1, d2nu8d1, d2nu8d2, d2nu8e1
   automatically matched to d1cqib2
   complexed with coa, gol, po4, so4; mutant

Details for d2nu8e2

PDB Entry: 2nu8, 2.15 Å

PDB Description: c123at mutant of e. coli succinyl-coa synthetase

PDB Compounds: (E:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nu8e2:

Sequence; same for both SEQRES and ATOM records:

>d2nu8e2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

Timeline for d2nu8e2:

• d2nu8e2 first appeared in SCOP 1.75
  
• d2nu8e2 appears in SCOPe 2.01
  
• d2nu8e2 appears in SCOPe 2.03
  
• d2nu8e2 appears in the current release, SCOPe 2.08