Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species) |
Species Escherichia coli [TaxId:562] [51902] (11 PDB entries) |
Domain d2nu8d1: 2nu8 D:1-121 [148416] Other proteins in same PDB: d2nu8a2, d2nu8b1, d2nu8b2, d2nu8d2, d2nu8e1, d2nu8e2 automated match to d1jkja1 complexed with coa, gol, po4, so4; mutant |
PDB Entry: 2nu8 (more details), 2.15 Å
SCOPe Domain Sequences for d2nu8d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu8d1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig p
Timeline for d2nu8d1: