Lineage for d2nu8a1 (2nu8 A:2-120)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 822143Family c.2.1.8: CoA-binding domain [51900] (5 proteins)
  6. 822160Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)
  7. 822161Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
  8. 822164Domain d2nu8a1: 2nu8 A:2-120 [148412]
    Other proteins in same PDB: d2nu8a2, d2nu8b1, d2nu8b2, d2nu8d2, d2nu8e1, d2nu8e2
    automatically matched to d1oi7a1
    complexed with coa, gol, po4, so4; mutant

Details for d2nu8a1

PDB Entry: 2nu8 (more details), 2.15 Å

PDB Description: c123at mutant of e. coli succinyl-coa synthetase
PDB Compounds: (A:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOP Domain Sequences for d2nu8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu8a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
ilidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreava
atgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig

SCOP Domain Coordinates for d2nu8a1:

Click to download the PDB-style file with coordinates for d2nu8a1.
(The format of our PDB-style files is described here.)

Timeline for d2nu8a1: