![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) ![]() |
![]() | Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
![]() | Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52216] (11 PDB entries) |
![]() | Domain d2nu7e1: 2nu7 E:239-385 [148410] Other proteins in same PDB: d2nu7a1, d2nu7a2, d2nu7b2, d2nu7d1, d2nu7d2, d2nu7e2 automated match to d1jkjb1 complexed with coa, po4, so4; mutant |
PDB Entry: 2nu7 (more details), 2.2 Å
SCOPe Domain Sequences for d2nu7e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu7e1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga kkladsglniiaakgltdaaqqvvaav
Timeline for d2nu7e1: