Lineage for d2nu7e1 (2nu7 E:239-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856295Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 2856296Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
  8. 2856300Domain d2nu7e1: 2nu7 E:239-385 [148410]
    Other proteins in same PDB: d2nu7a1, d2nu7a2, d2nu7b2, d2nu7d1, d2nu7d2, d2nu7e2
    automated match to d1jkjb1
    complexed with coa, po4, so4; mutant

Details for d2nu7e1

PDB Entry: 2nu7 (more details), 2.2 Å

PDB Description: c123as mutant of e. coli succinyl-coa synthetase
PDB Compounds: (E:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nu7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu7e1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOPe Domain Coordinates for d2nu7e1:

Click to download the PDB-style file with coordinates for d2nu7e1.
(The format of our PDB-style files is described here.)

Timeline for d2nu7e1: