![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) ![]() |
![]() | Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) automatically mapped to Pfam PF13549 automatically mapped to Pfam PF08442 |
![]() | Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [56083] (11 PDB entries) |
![]() | Domain d2nu7b2: 2nu7 B:1-238 [148407] Other proteins in same PDB: d2nu7a1, d2nu7a2, d2nu7b1, d2nu7d1, d2nu7d2, d2nu7e1 automated match to d1jkjb2 complexed with coa, po4, so4; mutant |
PDB Entry: 2nu7 (more details), 2.2 Å
SCOPe Domain Sequences for d2nu7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe
Timeline for d2nu7b2: