Lineage for d2nu6e2 (2nu6 E:1-238)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433194Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 1433195Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 1433196Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 1433204Domain d2nu6e2: 2nu6 E:1-238 [148403]
    Other proteins in same PDB: d2nu6a1, d2nu6a2, d2nu6b1, d2nu6d1, d2nu6d2, d2nu6e1
    automated match to d1jkjb2
    complexed with coa, so4; mutant

Details for d2nu6e2

PDB Entry: 2nu6 (more details), 2.55 Å

PDB Description: c123aa mutant of e. coli succinyl-coa synthetase
PDB Compounds: (E:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nu6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu6e2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d2nu6e2:

Click to download the PDB-style file with coordinates for d2nu6e2.
(The format of our PDB-style files is described here.)

Timeline for d2nu6e2: