SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nu6e1 (2nu6 E:239-385)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102261Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2102262Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 protein domains)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2102309Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 2102310Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
  8. 2102318Domain d2nu6e1: 2nu6 E:239-385 [148402]
    Other proteins in same PDB: d2nu6a1, d2nu6a2, d2nu6b2, d2nu6d1, d2nu6d2, d2nu6e2
    automated match to d1jkjb1
    complexed with coa, so4; mutant

Details for d2nu6e1

PDB Entry: 2nu6 (more details), 2.55 Å

PDB Description: C123aA Mutant of E. coli Succinyl-CoA Synthetase
PDB Compounds: (E:) succinyl-coa synthetase beta chain

SCOPe Domain Sequences for d2nu6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu6e1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOPe Domain Coordinates for d2nu6e1:

Click to download the PDB-style file with coordinates for d2nu6e1.
(The format of our PDB-style files is described here.)

Timeline for d2nu6e1: