Lineage for d2nu6d2 (2nu6 D:122-287)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856244Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)
  7. 2856247Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 2856255Domain d2nu6d2: 2nu6 D:122-287 [148401]
    Other proteins in same PDB: d2nu6a1, d2nu6b1, d2nu6b2, d2nu6d1, d2nu6e1, d2nu6e2
    automated match to d2scua2
    complexed with coa, so4; mutant

Details for d2nu6d2

PDB Entry: 2nu6 (more details), 2.55 Å

PDB Description: c123aa mutant of e. coli succinyl-coa synthetase
PDB Compounds: (D:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2nu6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nu6d2 c.23.4.1 (D:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
napgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

SCOPe Domain Coordinates for d2nu6d2:

Click to download the PDB-style file with coordinates for d2nu6d2.
(The format of our PDB-style files is described here.)

Timeline for d2nu6d2: