![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
![]() | Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [51902] (11 PDB entries) |
![]() | Domain d2nu6d1: 2nu6 D:2-120 [148400] Other proteins in same PDB: d2nu6a2, d2nu6b1, d2nu6b2, d2nu6d2, d2nu6e1, d2nu6e2 automatically matched to d1oi7a1 complexed with coa, so4; mutant |
PDB Entry: 2nu6 (more details), 2.55 Å
SCOPe Domain Sequences for d2nu6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu6d1 c.2.1.8 (D:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} ilidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreava atgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
Timeline for d2nu6d1: