SCOPe 2.08: Domain d2nu6a2: 2nu6 A:122-287

Lineage for d2nu6a2 (2nu6 A:122-287)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)

7. Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)

8. Domain d2nu6a2: 2nu6 A:122-287 [148397]
   Other proteins in same PDB: d2nu6a1, d2nu6b1, d2nu6b2, d2nu6d1, d2nu6e1, d2nu6e2
   automated match to d2scua2
   complexed with coa, so4; mutant

Details for d2nu6a2

PDB Entry: 2nu6, 2.55 Å

PDB Description: c123aa mutant of e. coli succinyl-coa synthetase

PDB Compounds: (A:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2nu6a2:

Sequence; same for both SEQRES and ATOM records:

>d2nu6a2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
napgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

Timeline for d2nu6a2:

• d2nu6a2 first appeared in SCOP 1.75
  
• d2nu6a2 appears in SCOPe 2.07