Class b: All beta proteins [48724] (174 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) |
Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins) |
Protein Griffithsin [141569] (2 species) single-chain subunits form a segment-swapped dimer |
Species Griffithsia sp. Q66D336 [TaxId:373036] [159279] (2 PDB entries) |
Domain d2nu5a1: 2nu5 A:1-121 [148394] automatically matched to d2gtya1 complexed with ace, nag, so4 |
PDB Entry: 2nu5 (more details), 1.56 Å
SCOP Domain Sequences for d2nu5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu5a1 b.77.3.1 (A:1-121) Griffithsin {Griffithsia sp. Q66D336 [TaxId: 373036]} slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq y
Timeline for d2nu5a1: