SCOP 1.75: Domain d2nu5a1: 2nu5 A:1-121

Lineage for d2nu5a1 (2nu5 A:1-121)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)

6. Protein Griffithsin [141569] (2 species)
   single-chain subunits form a segment-swapped dimer

7. Species Griffithsia sp. Q66D336 [TaxId:373036] [159279] (2 PDB entries)

8. Domain d2nu5a1: 2nu5 A:1-121 [148394]
   automatically matched to d2gtya1
   complexed with ace, nag, so4

Details for d2nu5a1

PDB Entry: 2nu5, 1.56 Å

PDB Description: crystal structure of a complex of griffithsin cocrystallized with n- acetylglucosamine

PDB Compounds: (A:) Griffithsin

SCOP Domain Sequences for d2nu5a1:

Sequence; same for both SEQRES and ATOM records:

>d2nu5a1 b.77.3.1 (A:1-121) Griffithsin {Griffithsia sp. Q66D336 [TaxId: 373036]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

Timeline for d2nu5a1:

• d2nu5a1 is new in SCOP 1.75
  
• d2nu5a1 is called d2nu5a_ in SCOPe 2.01
  
• d2nu5a1 appears in the current release, SCOPe 2.08, called d2nu5a_