![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
![]() | Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
![]() | Protein automated matches [190387] (4 species) not a true protein |
![]() | Species Griffithsia sp. [TaxId:373036] [187241] (1 PDB entry) |
![]() | Domain d2nu5a_: 2nu5 A: [148394] automated match to d2gtya1 complexed with nag, so4 |
PDB Entry: 2nu5 (more details), 1.56 Å
SCOPe Domain Sequences for d2nu5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nu5a_ b.77.3.1 (A:) automated matches {Griffithsia sp. [TaxId: 373036]} slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq y
Timeline for d2nu5a_: