SCOPe 2.08: Domain d2nu5a_: 2nu5 A:

Lineage for d2nu5a_ (2nu5 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein automated matches [190387] (4 species)
   not a true protein

7. Species Griffithsia sp. [TaxId:373036] [187241] (1 PDB entry)

8. Domain d2nu5a_: 2nu5 A: [148394]
   automated match to d2gtya1
   complexed with nag, so4

Details for d2nu5a_

PDB Entry: 2nu5, 1.56 Å

PDB Description: crystal structure of a complex of griffithsin cocrystallized with n- acetylglucosamine

PDB Compounds: (A:) Griffithsin

SCOPe Domain Sequences for d2nu5a_:

Sequence; same for both SEQRES and ATOM records:

>d2nu5a_ b.77.3.1 (A:) automated matches {Griffithsia sp. [TaxId: 373036]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

Timeline for d2nu5a_:

• d2nu5a_ first appeared in SCOP 1.75, called d2nu5a1
  
• d2nu5a_ appears in SCOPe 2.07