Lineage for d2nrka1 (2nrk A:4-170)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229335Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1229336Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 1229637Family d.218.1.14: GrpB-like [160260] (1 protein)
    Pfam PF04229, different set of active-site residues
  6. 1229638Protein Hypothetical protein GrpB [160261] (1 species)
  7. 1229639Species Enterococcus faecalis [TaxId:1351] [160262] (1 PDB entry)
    Uniprot Q837C3 4-170
  8. 1229640Domain d2nrka1: 2nrk A:4-170 [148379]

Details for d2nrka1

PDB Entry: 2nrk (more details), 1.65 Å

PDB Description: Crystal structure of conserved protein GrpB from Enterococcus faecalis
PDB Compounds: (A:) Hypothetical protein GrpB

SCOPe Domain Sequences for d2nrka1:

Sequence, based on SEQRES records: (download)

>d2nrka1 d.218.1.14 (A:4-170) Hypothetical protein GrpB {Enterococcus faecalis [TaxId: 1351]}
ivteyqpawveqfeeeaqalkqilkenclkvehigstsvpnlaakpiidflviveeiekv
dllqweferigyeymgefglsgrrylrkgpikrthhvhiyqfdntqeilrhlafrnylre
npaiattygtlkkqlaqahpdsidkymdgkdafikkiekealkkywe

Sequence, based on observed residues (ATOM records): (download)

>d2nrka1 d.218.1.14 (A:4-170) Hypothetical protein GrpB {Enterococcus faecalis [TaxId: 1351]}
ivteyqpawveqfeeeaqalkqilkenclkvehigstsvpnlaakpiidflviveeiekv
dllqweferigyeymgefglsgrrylrkgpikrthhvhiyqfdntqeilrhlafrnylre
npaiattygtlkkqlaqahpdsidkymkdafikkiekealkkywe

SCOPe Domain Coordinates for d2nrka1:

Click to download the PDB-style file with coordinates for d2nrka1.
(The format of our PDB-style files is described here.)

Timeline for d2nrka1: