SCOP 1.75: Domain d2nrka1: 2nrk A:4-170

Lineage for d2nrka1 (2nrk A:4-170)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families)

5. Family d.218.1.14: GrpB-like [160260] (1 protein)
   Pfam PF04229, different set of active-site residues

6. Protein Hypothetical protein GrpB [160261] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [160262] (1 PDB entry)
   Uniprot Q837C3 4-170

8. Domain d2nrka1: 2nrk A:4-170 [148379]

Details for d2nrka1

PDB Entry: 2nrk, 1.65 Å

PDB Description: Crystal structure of conserved protein GrpB from Enterococcus faecalis

PDB Compounds: (A:) Hypothetical protein GrpB

SCOP Domain Sequences for d2nrka1:

Sequence, based on SEQRES records:

>d2nrka1 d.218.1.14 (A:4-170) Hypothetical protein GrpB {Enterococcus faecalis [TaxId: 1351]}
ivteyqpawveqfeeeaqalkqilkenclkvehigstsvpnlaakpiidflviveeiekv
dllqweferigyeymgefglsgrrylrkgpikrthhvhiyqfdntqeilrhlafrnylre
npaiattygtlkkqlaqahpdsidkymdgkdafikkiekealkkywe

Sequence, based on observed residues (ATOM records):

>d2nrka1 d.218.1.14 (A:4-170) Hypothetical protein GrpB {Enterococcus faecalis [TaxId: 1351]}
ivteyqpawveqfeeeaqalkqilkenclkvehigstsvpnlaakpiidflviveeiekv
dllqweferigyeymgefglsgrrylrkgpikrthhvhiyqfdntqeilrhlafrnylre
npaiattygtlkkqlaqahpdsidkymkdafikkiekealkkywe

Timeline for d2nrka1:

• d2nrka1 is new in SCOP 1.75
  
• d2nrka1 appears in SCOPe 2.01
  
• d2nrka1 appears in the current release, SCOPe 2.08