![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins) catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest |
![]() | Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries) |
![]() | Domain d2nrcb1: 2nrc B:260-480 [148372] Other proteins in same PDB: d2nrca2, d2nrcb2, d2nrcc2, d2nrcd2 automated match to d1ooza1 mutant |
PDB Entry: 2nrc (more details), 2.05 Å
SCOPe Domain Sequences for d2nrcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nrcb1 c.124.1.3 (B:260-480) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgk lvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdv drkkgltlielwegltvddikkstgcdfavspklipmqqvt
Timeline for d2nrcb1: