Lineage for d2nrca1 (2nrc A:261-480)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849026Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 849027Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families) (S)
  5. 849117Family c.124.1.3: CoA transferase beta subunit-like [74657] (3 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 849136Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)
  7. 849137Species Pig (Sus scrofa) [TaxId:9823] [82467] (7 PDB entries)
  8. 849142Domain d2nrca1: 2nrc A:261-480 [148370]
    Other proteins in same PDB: d2nrca2, d2nrcb2, d2nrcc2, d2nrcd2
    automatically matched to d1m3eb2
    mutant

Details for d2nrca1

PDB Entry: 2nrc (more details), 2.05 Å

PDB Description: c28a mutant of succinyl-coa:3-ketoacid coa transferase from pig heart
PDB Compounds: (A:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1

SCOP Domain Sequences for d2nrca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrca1 c.124.1.3 (A:261-480) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvt

SCOP Domain Coordinates for d2nrca1:

Click to download the PDB-style file with coordinates for d2nrca1.
(The format of our PDB-style files is described here.)

Timeline for d2nrca1: