![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins) catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest |
![]() | Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries) |
![]() | Domain d2nrbd1: 2nrb D:260-480 [148368] Other proteins in same PDB: d2nrba2, d2nrbb2, d2nrbc2, d2nrbd2 automated match to d1ooza1 complexed with cl; mutant |
PDB Entry: 2nrb (more details), 2 Å
SCOPe Domain Sequences for d2nrbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nrbd1 c.124.1.3 (D:260-480) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgk lvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdv drkkgltlielwegltvddikkstgcdfavspklipmqqvt
Timeline for d2nrbd1: