Lineage for d2nrbc2 (2nrb C:1-247)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529545Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2529546Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2529592Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 2529627Protein Succinate:CoA transferase, N-terminal domain [82464] (2 species)
  7. 2529633Species Pig (Sus scrofa) [TaxId:9823] [82465] (8 PDB entries)
  8. 2529648Domain d2nrbc2: 2nrb C:1-247 [148367]
    Other proteins in same PDB: d2nrba1, d2nrbb1, d2nrbc1, d2nrbd1
    automated match to d1m3ea1
    complexed with cl; mutant

Details for d2nrbc2

PDB Entry: 2nrb (more details), 2 Å

PDB Description: c28s mutant of succinyl-coa:3-ketoacid coa transferase from pig heart
PDB Compounds: (C:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1

SCOPe Domain Sequences for d2nrbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrbc2 c.124.1.2 (C:1-247) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
tkfytdaveavkdipngatvlvggfglsgipenligallktgvkeltavsnnagvdnfgl
glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
erlsvrk

SCOPe Domain Coordinates for d2nrbc2:

Click to download the PDB-style file with coordinates for d2nrbc2.
(The format of our PDB-style files is described here.)

Timeline for d2nrbc2: