Lineage for d2nrac1 (2nra C:9-151)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982452Family a.4.5.10: Replication initiation protein [46816] (3 protein domains)
    duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
  6. 1982461Protein Replication initiation protein PI [158284] (1 species)
  7. 1982462Species Escherichia coli [TaxId:562] [158285] (1 PDB entry)
    Uniprot P03067 152-268! Uniprot P03067 9-151
  8. 1982463Domain d2nrac1: 2nra C:9-151 [148360]
    protein/DNA complex

Details for d2nrac1

PDB Entry: 2nra (more details), 3.1 Å

PDB Description: Crystal structure of Pi initiator protein in complex with iteron DNA
PDB Compounds: (C:) PI protein

SCOPe Domain Sequences for d2nrac1:

Sequence, based on SEQRES records: (download)

>d2nrac1 a.4.5.10 (C:9-151) Replication initiation protein PI {Escherichia coli [TaxId: 562]}
vnkktkirhrnelnhtlaqlplpakrvmymalalidskeplergrvfkiraedlaalaki
tpslayrqlkeggkllgaskislrgddiialakelnllstaknsseeldlniiewiaysp
degylslkftrtiepyissligk

Sequence, based on observed residues (ATOM records): (download)

>d2nrac1 a.4.5.10 (C:9-151) Replication initiation protein PI {Escherichia coli [TaxId: 562]}
vnkktkirhrnelnhtlaqlplpakrvmymalalidskeplergrvfkiraedlaalaki
tpslayrqlkeggkllgaskislrgddiialakelnseeldlniiewiayspdegylslk
ftrtiepyissligk

SCOPe Domain Coordinates for d2nrac1:

Click to download the PDB-style file with coordinates for d2nrac1.
(The format of our PDB-style files is described here.)

Timeline for d2nrac1: