SCOPe 2.08: Domain d2nr7a1: 2nr7 A:1-192

Lineage for d2nr7a1 (2nr7 A:1-192)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.9: NMB1012-like [159827] (3 proteins)
   Pfam PF05838; predicted lysozyme (DUF847)

6. Protein Putative secretion activator PG0293 [159830] (1 species)

7. Species Porphyromonas gingivalis [TaxId:837] [159831] (1 PDB entry)
   Uniprot Q7MXB3 1-192

8. Domain d2nr7a1: 2nr7 A:1-192 [148359]
   Other proteins in same PDB: d2nr7a2
   different conformation of the superfamily motif region

Details for d2nr7a1

PDB Entry: 2nr7, 1.3 Å

PDB Description: Structural Genomics, the crystal structure of putative secretion activator protein from Porphyromonas gingivalis W83

PDB Compounds: (A:) Secretion activator protein, putative

SCOPe Domain Sequences for d2nr7a1:

Sequence; same for both SEQRES and ATOM records:

>d2nr7a1 d.2.1.9 (A:1-192) Putative secretion activator PG0293 {Porphyromonas gingivalis [TaxId: 837]}
manvklllpyilkweggfvhdpadaggatnkgvtiatwkrvgydkdgdgdidvedlkllt
dddvlnrvlkpfywdrwkadliesqkvanilvdwvwgsgkygivipqrilgvqadgivgn
ktlqavnsadpdelfesifdarrefleditarsikkyedsigrkaterellrhtnkrflr
gwlnrledirkl

Timeline for d2nr7a1:

• d2nr7a1 first appeared in SCOP 1.75
  
• d2nr7a1 appears in SCOPe 2.07