Lineage for d2nr6f_ (2nr6 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744932Domain d2nr6f_: 2nr6 F: [148358]
    Other proteins in same PDB: d2nr6a1, d2nr6a2, d2nr6b1, d2nr6b2, d2nr6c1, d2nr6c2, d2nr6e1, d2nr6e2
    automated match to d6shgh_
    complexed with nag, zn

Details for d2nr6f_

PDB Entry: 2nr6 (more details), 2.81 Å

PDB Description: crystal structure of the complex of antibody and the allergen bla g 2
PDB Compounds: (F:) antibody heavy chain

SCOPe Domain Sequences for d2nr6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nr6f_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eiqlqqsgaelvkpgasvklsctasgfnikdtyihwvkqrpeqglewigridpangntry
gpkflgkatitadtssntaylhlnsltsedtavyfcarwvrqmdywgqgtsvtvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkki

SCOPe Domain Coordinates for d2nr6f_:

Click to download the PDB-style file with coordinates for d2nr6f_.
(The format of our PDB-style files is described here.)

Timeline for d2nr6f_: