![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d2nr6f_: 2nr6 F: [148358] Other proteins in same PDB: d2nr6a1, d2nr6a2, d2nr6b1, d2nr6b2, d2nr6c1, d2nr6c2, d2nr6e1, d2nr6e2 automated match to d6shgh_ complexed with nag, zn |
PDB Entry: 2nr6 (more details), 2.81 Å
SCOPe Domain Sequences for d2nr6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nr6f_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eiqlqqsgaelvkpgasvklsctasgfnikdtyihwvkqrpeqglewigridpangntry gpkflgkatitadtssntaylhlnsltsedtavyfcarwvrqmdywgqgtsvtvssaktt ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl sssvtvpsstwpsetvtcnvahpasstkvdkki
Timeline for d2nr6f_: