Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.6: SO2669-like [158418] (1 family) (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
Family a.25.6.1: SO2669-like [158419] (1 protein) |
Protein Hypothetical protein SO2669 [158420] (1 species) |
Species Shewanella oneidensis [TaxId:70863] [158421] (1 PDB entry) Uniprot Q8EDS4 1-64 |
Domain d2nr5g1: 2nr5 G:3-64 [148355] automatically matched to 2NR5 A:1-64 complexed with act, mpd |
PDB Entry: 2nr5 (more details), 1.9 Å
SCOP Domain Sequences for d2nr5g1:
Sequence, based on SEQRES records: (download)
>d2nr5g1 a.25.6.1 (G:3-64) Hypothetical protein SO2669 {Shewanella oneidensis [TaxId: 70863]} tkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwgesp ia
>d2nr5g1 a.25.6.1 (G:3-64) Hypothetical protein SO2669 {Shewanella oneidensis [TaxId: 70863]} tkkeriaiqrsmaeealgklkairqlcgaessdmqeveiwtnrikeledwlwgespia
Timeline for d2nr5g1: