| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.6: SO2669-like [158418] (1 family) ![]() (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
| Family a.25.6.1: SO2669-like [158419] (2 proteins) |
| Protein automated matches [190741] (1 species) not a true protein |
| Species Shewanella oneidensis [TaxId:211586] [187922] (1 PDB entry) |
| Domain d2nr5e2: 2nr5 E:1-64 [148353] Other proteins in same PDB: d2nr5a1, d2nr5e3 automated match to d2nr5a1 complexed with act, mpd |
PDB Entry: 2nr5 (more details), 1.9 Å
SCOPe Domain Sequences for d2nr5e2:
Sequence, based on SEQRES records: (download)
>d2nr5e2 a.25.6.1 (E:1-64) automated matches {Shewanella oneidensis [TaxId: 211586]}
mmtkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwge
spia
>d2nr5e2 a.25.6.1 (E:1-64) automated matches {Shewanella oneidensis [TaxId: 211586]}
mmtkkeriaiqrsmaeealgklkairqlcgaedssdsmqeveiwtnrikeledwlwgesp
ia
Timeline for d2nr5e2: