SCOP 1.75: Domain d2nr5b1: 2nr5 B:1-64

Lineage for d2nr5b1 (2nr5 B:1-64)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.6: SO2669-like [158418] (1 family)
   (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.6.1: SO2669-like [158419] (1 protein)

6. Protein Hypothetical protein SO2669 [158420] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [158421] (1 PDB entry)
   Uniprot Q8EDS4 1-64

8. Domain d2nr5b1: 2nr5 B:1-64 [148350]
   automatically matched to 2NR5 A:1-64
   complexed with act, mpd

Details for d2nr5b1

PDB Entry: 2nr5, 1.9 Å

PDB Description: Crystal Structure of Protein of Unknown Function SO2669 from Shewanella oneidensis MR-1

PDB Compounds: (B:) Hypothetical protein SO2669

SCOP Domain Sequences for d2nr5b1:

Sequence, based on SEQRES records:

>d2nr5b1 a.25.6.1 (B:1-64) Hypothetical protein SO2669 {Shewanella oneidensis [TaxId: 70863]}
mmtkkeriaiqrsmaeealgklkairqlcgaedssdssdmqeveiwtnrikeledwlwge
spia

Sequence, based on observed residues (ATOM records):

>d2nr5b1 a.25.6.1 (B:1-64) Hypothetical protein SO2669 {Shewanella oneidensis [TaxId: 70863]}
mmtkkeriaiqrsmaeealgklkairqlcgaedmqeveiwtnrikeledwlwgespia

Timeline for d2nr5b1:

• d2nr5b1 is new in SCOP 1.75
  
• d2nr5b1 is called d2nr5b_ in SCOPe 2.01
  
• d2nr5b1 appears in the current release, SCOPe 2.08, called d2nr5b_