Class b: All beta proteins [48724] (176 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.4: MTH863-like [159164] (3 proteins) Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold (46965) |
Protein Hypothetical protein MM1853 [159167] (1 species) |
Species Methanosarcina mazei [TaxId:2209] [159168] (1 PDB entry) Uniprot Q8PVV4 19-210 |
Domain d2nr4b_: 2nr4 B: [148348] automated match to d2nr4a1 complexed with fmn |
PDB Entry: 2nr4 (more details), 1.85 Å
SCOPe Domain Sequences for d2nr4b_:
Sequence, based on SEQRES records: (download)
>d2nr4b_ b.45.1.4 (B:) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]} dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn vvydpilfvrstfsdlvpsefeyvdagefkfpvlkeaiawvvfecinlrntdqslvadlv plnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggda ekkamkliyeal
>d2nr4b_ b.45.1.4 (B:) Hypothetical protein MM1853 {Methanosarcina mazei [TaxId: 2209]} dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn vvydpilfvrstflvpsefeyvdagefkfpvlkeaiawvvfecinlrntslvadlvplna gfnernikelpvpnrgfnavleatvhatryqylelirhyeslaskcggdaekkamkliye al
Timeline for d2nr4b_: