Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
Protein Hypothetical protein PG0272 [160833] (1 species) |
Species Porphyromonas gingivalis [TaxId:837] [160834] (1 PDB entry) Uniprot Q7MXD1 327-413 |
Domain d2nqwa1: 2nqw A:4-90 [148346] complexed with gol |
PDB Entry: 2nqw (more details), 1.3 Å
SCOPe Domain Sequences for d2nqwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqwa1 d.145.1.4 (A:4-90) Hypothetical protein PG0272 {Porphyromonas gingivalis [TaxId: 837]} lpfkvlgdgsylfegktslsdvrhyldlpenafgelgdevdtlsglfleikqelphvgdt avyepfrfqvtqmdkrriieikifpfe
Timeline for d2nqwa1: