Lineage for d2nqwa1 (2nqw A:4-90)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987644Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 2987670Protein Hypothetical protein PG0272 [160833] (1 species)
  7. 2987671Species Porphyromonas gingivalis [TaxId:837] [160834] (1 PDB entry)
    Uniprot Q7MXD1 327-413
  8. 2987672Domain d2nqwa1: 2nqw A:4-90 [148346]
    complexed with gol

Details for d2nqwa1

PDB Entry: 2nqw (more details), 1.3 Å

PDB Description: Structure of the transporter associated domain from PG_0272, a CBS domain protein from Porphyromonas gingivalis
PDB Compounds: (A:) CBS domain protein

SCOPe Domain Sequences for d2nqwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqwa1 d.145.1.4 (A:4-90) Hypothetical protein PG0272 {Porphyromonas gingivalis [TaxId: 837]}
lpfkvlgdgsylfegktslsdvrhyldlpenafgelgdevdtlsglfleikqelphvgdt
avyepfrfqvtqmdkrriieikifpfe

SCOPe Domain Coordinates for d2nqwa1:

Click to download the PDB-style file with coordinates for d2nqwa1.
(The format of our PDB-style files is described here.)

Timeline for d2nqwa1: