SCOPe 2.04: Domain d2nqca_: 2nqc A:

Lineage for d2nqca_ (2nqc A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein automated matches [190375] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187222] (5 PDB entries)

8. Domain d2nqca_: 2nqc A: [148344]
   automated match to d2nqca1
   complexed with gol, imd, ni

Details for d2nqca_

PDB Entry: 2nqc, 2.05 Å

PDB Description: crystal structure of ig-like domain 23 from human filamin c

PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d2nqca_:

Sequence; same for both SEQRES and ATOM records:

>d2nqca_ b.1.18.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agdpglvsaygpgleggttgvssefivntlnagsgalsvtidgpskvqldcrecpeghvv
tytpmapgnyliaikyggpqhivgspfkakvtgprls

Timeline for d2nqca_:

• d2nqca_ first appeared in SCOP 1.75, called d2nqca1
  
• d2nqca_ was called d2nqca1 in SCOPe 2.03
  
• d2nqca_ appears in SCOPe 2.05
  
• d2nqca_ appears in the current release, SCOPe 2.08