Lineage for d2nqca1 (2nqc A:2482-2578)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299994Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 1300031Protein Filamin C [117049] (1 species)
  7. 1300032Species Human (Homo sapiens) [TaxId:9606] [117050] (7 PDB entries)
    Uniprot Q14315 2633-2725
  8. 1300034Domain d2nqca1: 2nqc A:2482-2578 [148344]
    automatically matched to d2d7qa1
    complexed with gol, imd, ni

Details for d2nqca1

PDB Entry: 2nqc (more details), 2.05 Å

PDB Description: crystal structure of ig-like domain 23 from human filamin c
PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d2nqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
agdpglvsaygpgleggttgvssefivntlnagsgalsvtidgpskvqldcrecpeghvv
tytpmapgnyliaikyggpqhivgspfkakvtgprls

SCOPe Domain Coordinates for d2nqca1:

Click to download the PDB-style file with coordinates for d2nqca1.
(The format of our PDB-style files is described here.)

Timeline for d2nqca1: