SCOPe 2.06: Domain d2nqbf_: 2nqb F:

Lineage for d2nqbf_ (2nqb F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158387] (2 PDB entries)

8. Domain d2nqbf_: 2nqb F: [148343]
   Other proteins in same PDB: d2nqbc_, d2nqbd_, d2nqbg_, d2nqbh_
   automated match to d1kx5b_
   protein/DNA complex

Details for d2nqbf_

PDB Entry: 2nqb, 2.3 Å

PDB Description: drosophila nucleosome structure

PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d2nqbf_:

Sequence; same for both SEQRES and ATOM records:

>d2nqbf_ a.22.1.1 (F:) Histone H4 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
krktvtamdvvyalkrqgrtlygfgg

Timeline for d2nqbf_:

• d2nqbf_ first appeared in SCOP 1.75, called d2nqbf1
  
• d2nqbf_ appears in SCOPe 2.05
  
• d2nqbf_ appears in SCOPe 2.07
  
• d2nqbf_ appears in the current release, SCOPe 2.08