SCOP 1.75: Domain d2nqbf1: 2nqb F:222-302

Lineage for d2nqbf1 (2nqb F:222-302)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (5 species)

7. Species fruit fly (Drosophila melanogaster) [TaxId:7227] [158387] (2 PDB entries)

8. Domain d2nqbf1: 2nqb F:222-302 [148343]
   Other proteins in same PDB: d2nqba1, d2nqbe1
   automatically matched to d1p3ob_

Details for d2nqbf1

PDB Entry: 2nqb, 2.3 Å

PDB Description: drosophila nucleosome structure

PDB Compounds: (F:) histone h4

SCOP Domain Sequences for d2nqbf1:

Sequence; same for both SEQRES and ATOM records:

>d2nqbf1 a.22.1.1 (F:222-302) Histone H4 {fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
tamdvvyalkrqgrtlygfgg

Timeline for d2nqbf1:

• d2nqbf1 is new in SCOP 1.75
  
• d2nqbf1 appears in SCOPe 2.01
  
• d2nqbf1 appears in the current release, SCOPe 2.08, called d2nqbf_