Lineage for d2nqba1 (2nqb A:438-535)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764992Protein Histone H3 [47122] (5 species)
  7. 765064Species fruit fly (Drosophila melanogaster) [TaxId:7227] [158386] (2 PDB entries)
  8. 765065Domain d2nqba1: 2nqb A:438-535 [148340]
    Other proteins in same PDB: d2nqbb1, d2nqbf1
    automatically matched to d1eqzc_

Details for d2nqba1

PDB Entry: 2nqb (more details), 2.3 Å

PDB Description: drosophila nucleosome structure
PDB Compounds: (A:) histone h3

SCOP Domain Sequences for d2nqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqba1 a.22.1.1 (A:438-535) Histone H3 {fruit fly (Drosophila melanogaster) [TaxId: 7227]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d2nqba1:

Click to download the PDB-style file with coordinates for d2nqba1.
(The format of our PDB-style files is described here.)

Timeline for d2nqba1: