SCOPe 2.06: Domain d2npoa1: 2npo A:3-195

Lineage for d2npoa1 (2npo A:3-195)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.8: PglD-like [159280] (2 proteins)
   contains extra N-terminal alpha/beta subdomain
   this is a repeat family; one repeat unit is 2npo A:101-119 found in domain

6. Protein Acetyltransferase PglD [159281] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries)
   Uniprot Q0P9D1 3-197

8. Domain d2npoa1: 2npo A:3-195 [148338]
   Other proteins in same PDB: d2npoa2

Details for d2npoa1

PDB Entry: 2npo, 2.2 Å

PDB Description: crystal structure of putative transferase from campylobacter jejuni subsp. jejuni nctc 11168

PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d2npoa1:

Sequence, based on SEQRES records:

>d2npoa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
rtekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirk
kiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssv
iehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqd
ekgvfvgvpakrm

Sequence, based on observed residues (ATOM records):

>d2npoa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
rtekiyiygghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirkki
yqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvie
hecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdek
gvfvgvpakrm

Timeline for d2npoa1:

• d2npoa1 first appeared in SCOP 1.75
  
• d2npoa1 appears in SCOPe 2.05
  
• d2npoa1 appears in SCOPe 2.07
  
• d2npoa1 appears in the current release, SCOPe 2.08